Protein Info for SMc03185 in Sinorhizobium meliloti 1021

Annotation: NADPH dehydrogenase quinone reductase transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF02525: Flavodoxin_2" amino acids 1 to 213 (213 residues), 182 bits, see alignment E=1.2e-57 PF03358: FMN_red" amino acids 1 to 155 (155 residues), 43.1 bits, see alignment E=3.3e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2970)

MetaCyc: 100% identical to roxarsone nitroreductase (Sinorhizobium meliloti)
1.7.1.M3 [EC: 1.7.1.M3]; 1.7.1.M3 [EC: 1.7.1.M3]; 1.7.1.M3 [EC: 1.7.1.M3]; 1.7.1.M3 [EC: 1.7.1.M3]

Predicted SEED Role

"NAD(P)H oxidoreductase YRKL (EC 1.6.99.-) @ Putative NADPH-quinone reductase (modulator of drug activity B) @ Flavodoxin 2" (EC 1.6.99.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.6.99.-

Use Curated BLAST to search for 1.6.99.- or 1.7.1.M3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LV5 at UniProt or InterPro

Protein Sequence (270 amino acids)

>SMc03185 NADPH dehydrogenase quinone reductase transmembrane protein (Sinorhizobium meliloti 1021)
MKILLVFAHPESRSLNGALRDVAIEELTAQGHEVRVSDLYADGWKSEVGHADFPLLPPDA
RLVPVAASKTAFEAGALTEDVKAEIEKLLWADVLILQFPLWWFSMPAILKGWVDRVFAYG
FAYGVGEHSDKRWGDRYGEGSLAGKRAMLIVTAGGWEEHYSARGVNGPIDDLLFPINHGI
LYYPGYDVLPPFVAYRADRLDEAGFTEVAEGLRERMRTIGTVSPIPYRQQNGGDYLIPSM
QLRPGLGDPAAPSFALHLNETREALRQAGE