Protein Info for SMc03180 in Sinorhizobium meliloti 1021

Annotation: monovalent cation/H+ antiporter subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 115 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details TIGR00941: multicomponent Na+:H+ antiporter, MnhC subunit" amino acids 1 to 108 (108 residues), 168.7 bits, see alignment E=2.1e-54 PF00420: Oxidored_q2" amino acids 6 to 109 (104 residues), 76.3 bits, see alignment E=6.8e-26

Best Hits

Swiss-Prot: 100% identical to PHAC1_RHIME: Probable K(+)/H(+) antiporter subunit C (phaC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K05560, multicomponent K+:H+ antiporter subunit C (inferred from 100% identity to sme:SMc03180)

Predicted SEED Role

"Na(+) H(+) antiporter subunit C" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q52980 at UniProt or InterPro

Protein Sequence (115 amino acids)

>SMc03180 monovalent cation/H+ antiporter subunit C (Sinorhizobium meliloti 1021)
MELILSAGIGTLTASGVYLLLRPRTYQVIIGLSLLSFAVNLFIFGMGRLRVNAPPILDPG
GVGDLARYTDPVPQALVLTAIVIGFAMTALFLVVLLASRGFTGTDHVDGREQRGD