Protein Info for SMc03161 in Sinorhizobium meliloti 1021

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 PF01408: GFO_IDH_MocA" amino acids 15 to 142 (128 residues), 75.9 bits, see alignment E=6.9e-25 PF22725: GFO_IDH_MocA_C3" amino acids 153 to 289 (137 residues), 93.1 bits, see alignment E=2.1e-30 PF02894: GFO_IDH_MocA_C" amino acids 157 to 394 (238 residues), 64.8 bits, see alignment E=1.6e-21

Best Hits

Swiss-Prot: 44% identical to Y4HM_SINFN: Uncharacterized oxidoreductase y4hM (NGR_a03370) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 100% identity to sme:SMc03161)

Predicted SEED Role

"Oxidoreductase, Gfo/Idh/MocA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LX1 at UniProt or InterPro

Protein Sequence (394 amino acids)

>SMc03161 oxidoreductase (Sinorhizobium meliloti 1021)
MAIEGSSTETRQKRIRLGMVGGGSGAFIGAVHRIAARLDDHYELVAGALSSTPEKAEASG
RELGLDPSRVYSDFKEMAIREAKLKNGIEAVAIVTPNHVHYAAAKEFLKRGIHVICDKPL
TSTLADAKKLKKAADESDALFVLTHNYTGYPMVRQAREMIENGDIGAVRLVQMEYPQDWL
TENIEQSGQKQAAWRTDPARSGAGGSTGDIGTHAYNLGCFVSGLELEELAADLDSFVGGR
QLDDNAHVLMRFREKDGTRAKGMLWCSQVAPGHENGLMVRVYGTKGGLEWTQKDPNYLWY
TPFGEPKRLLTRAGAGASPAAARVSRIPSGHPEGYLEGFANIYSEAARAIYAKRNGGKAD
PSVIYPTIDDGMRGMTFVDACVRSSERNGAWIKV