Protein Info for SMc03133 in Sinorhizobium meliloti 1021

Annotation: amino-acid transport system permease ABC transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 55 to 74 (20 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 122 to 146 (25 residues), see Phobius details amino acids 153 to 178 (26 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 227 to 244 (18 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 117 to 212 (96 residues), 98.7 bits, see alignment E=1.2e-32 PF00528: BPD_transp_1" amino acids 141 to 317 (177 residues), 87.5 bits, see alignment E=4.8e-29

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to smk:Sinme_3015)

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LS0 at UniProt or InterPro

Protein Sequence (323 amino acids)

>SMc03133 amino-acid transport system permease ABC transporter protein (Sinorhizobium meliloti 1021)
MIGRMILTYPDAARRTGTFLLLALITLTVYSLGVSPAWIGLVLPTSSEWLAANPALGRLV
GAVMIAVIAALNWKALRQLPRRWQVAGVWLELFALLMLFFYSFNLSFAFIAKKLSFLISQ
GVVTTLYISVISIAVATVIALVGAIAKLSKNGVIYGLATFYTSLFRGLPLLMQIYIIYLG
LPQVGYVISAVPAGILALSLCYGAYMTEIFRAGIESIPRGQTEGATALGLSPSQTMGLVI
LPQAMRVIIPPTGNQFIAMLKDSSLISVVGVWELMYLARTQGQTEFRHIEMLITASMIYW
ILSIGLEYMQSRVEARFGRFNVR