Protein Info for SMc03062 in Sinorhizobium meliloti 1021

Updated annotation (from data): ABC transporter for D-maltose/D-trehalose/sucrose, permease component 1 (AglF)
Rationale: Specific phenotype on D-Maltose monohydrate; D-Trehalose dihydrate. Also mildly important for D-cellobiose utilization, which has its own ABC transporter, so the cause is unclear. Also reported to transport sucrose (PMID:10400573, PMID:12003938)
Original annotation: alpha-glucoside ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 178 to 194 (17 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 254 to 278 (25 residues), see Phobius details amino acids 304 to 326 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 124 to 322 (199 residues), 54.6 bits, see alignment E=6.2e-19

Best Hits

Swiss-Prot: 100% identical to AGLF_RHIME: Alpha-glucoside transport system permease protein AglF (aglF) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K10233, alpha-glucoside transport system permease protein (inferred from 100% identity to sme:SMc03062)

Predicted SEED Role

"ABC alpha-glucoside transporter, inner membrane subunit AglF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9Z3R6 at UniProt or InterPro

Protein Sequence (336 amino acids)

>SMc03062 ABC transporter for D-maltose/D-trehalose/sucrose, permease component 1 (AglF) (Sinorhizobium meliloti 1021)
MEQLIAAILTMVAGVLVCAAYFWSTNLVLDWIFPSKGKFGAVASRNLRIANSIRPWLFLA
PALLALTLYLVYPVVQSVWLSLHGRGGQNFVGLSNYSWMINDGEFRQSIFNNFLWLLVVP
ALSTFFGLIIAALTDRIWWGNIAKTLIFMPMAISFVGAAVIWKFIYDYRAAGSEQIGLLN
AIVVALGGEPQAWITLPFWNNFFLMVILIWIQTGFAMVILSAALRGIPEETIEAAVIDGA
NGWQIFFKIMVPQIWGTIAVVWTTITILVLKVFDIVLAMTNGQWQSQVLANLMFDWMFRG
GGDFGRGAAIAVVIMILVVPIMIWNIRNATRESGGH