Protein Info for SMc03044 in Sinorhizobium meliloti 1021

Annotation: chemotaxis protein (motility protein D)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 PF02120: Flg_hook" amino acids 331 to 408 (78 residues), 55.3 bits, see alignment E=2.3e-19

Best Hits

Swiss-Prot: 92% identical to MOTD_RHIML: Chemotaxis protein MotD (motD) from Rhizobium meliloti

KEGG orthology group: K10565, chemotaxis protein MotD (inferred from 100% identity to sme:SMc03044)

Predicted SEED Role

"Flagellar hook-length control protein FliK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RZ5 at UniProt or InterPro

Protein Sequence (475 amino acids)

>SMc03044 chemotaxis protein (motility protein D) (Sinorhizobium meliloti 1021)
MRPLDENLRTSAASRPAQSLSVRGQPEAESGAFGEAIADAGRRRTQGQGGQTSADDARRD
SVANGGNASAVPKADGFGADVPASTADAASPDARPAYERAIITRDQAAKRLQHSHPAGTR
HLSQGREDGGEEIAQPAERAVVRSRETVQTSRDSVDEASGVTAREGGENGDPASGTVSDL
LSMLTGAAPAVAAASQPEGRAKPASAVRDGSDGPAKAVGGISPAVPDGEHPQTGEGTGGS
EPDRLFRFARADGKGQAVSMNISRDGERAVVENSRSSVKPGVETVTVLEARRYLGLAVNE
NATSVTTAIAGDSGWAEALQSSAATTKPEAWSQAGKTLNTLKIQMHPVDLGMVTATLRLK
DDELQVDLKVETGEAFRQLRDDQSEMVKALRAQGFAVDQVNIVFNGGGDSASGGGGQSQA
QAQLGYEGRERAGDDGQGRQPRDGGRAATERWAGNDATDDVPDGAERSRAGHVYM