Protein Info for SMc03025 in Sinorhizobium meliloti 1021

Annotation: flagellum-specific ATP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 TIGR01026: ATPase, FliI/YscN family" amino acids 36 to 442 (407 residues), 419.5 bits, see alignment E=1.4e-129 TIGR03498: flagellar protein export ATPase FliI" amino acids 36 to 448 (413 residues), 618.5 bits, see alignment E=5e-190 PF00006: ATP-synt_ab" amino acids 160 to 370 (211 residues), 268.6 bits, see alignment E=3.9e-84 PF18269: T3SS_ATPase_C" amino acids 378 to 441 (64 residues), 49.1 bits, see alignment E=4.2e-17

Best Hits

Swiss-Prot: 100% identical to FLII_RHIME: Flagellum-specific ATP synthase (fliI) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02412, flagellum-specific ATP synthase [EC: 3.6.3.14] (inferred from 100% identity to smk:Sinme_0351)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See O54249 at UniProt or InterPro

Protein Sequence (467 amino acids)

>SMc03025 flagellum-specific ATP synthase (Sinorhizobium meliloti 1021)
MAREAAEKTATSTSLAALAGLVERYANPDFAIAPGGHVQTISPGHYTVSGLSRHVRLGDF
VAHKSTTGTHLGEVVRVEPERVVVCPIEPGDPIGIHDVVIRKGAFRIAPTDNWCGRTINA
LAEPIDGLGALLQGDIRRSIANTAPPSMTRKRVEQGFRTGVRAIDIFSPLCLGQRLGIFA
GSGVGKSTLLSMLARADAFDKVVIALVGERGREVREFIEDTLGDNLSKSVAVVATSDESP
MLRKMAPLTAVTIAEHYRDKGDNVLLIVDSVTRFAHAIREVATAAGEPPIARGYPASVFT
ELPRLLERAGPGAEGAGTITAIISILVDGDNHNDPVADSARGILDGHIVLDRSLAEEGRY
PPVNPLASISRLARKAWTPDQEKLVARLKSLIHRFEETRDLRLIGGYRPGGDADLDMAIK
QVPVIYDVLKQMPGERPAFDAFTDLANALKAAAMGNQPGAAGLRGRG