Protein Info for SMc03024 in Sinorhizobium meliloti 1021

Annotation: flagellar basal body rod protein FlgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR03506: flagellar hook-basal body protein" amino acids 4 to 119 (116 residues), 123.4 bits, see alignment E=1.8e-39 TIGR02490: flagellar basal-body rod protein FlgF" amino acids 5 to 217 (213 residues), 186.9 bits, see alignment E=3.7e-59 PF00460: Flg_bb_rod" amino acids 5 to 35 (31 residues), 38 bits, see alignment 1.9e-13 PF22692: LlgE_F_G_D1" amino acids 80 to 144 (65 residues), 46.7 bits, see alignment E=4.3e-16 PF06429: Flg_bbr_C" amino acids 191 to 234 (44 residues), 41.4 bits, see alignment 1.2e-14

Best Hits

Swiss-Prot: 100% identical to FLGF_RHIME: Flagellar basal-body rod protein FlgF (flgF) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02391, flagellar basal-body rod protein FlgF (inferred from 100% identity to sme:SMc03024)

Predicted SEED Role

"Flagellar basal-body rod protein FlgF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See O54248 at UniProt or InterPro

Protein Sequence (241 amino acids)

>SMc03024 flagellar basal body rod protein FlgF (Sinorhizobium meliloti 1021)
MQTGLYVALSSQMALEKRLNTLADNIANSNTVGFRATEVKFNQVLGDTKPTKVSYVSEGE
EFLSTKTGALARTGSALDFAIKGDAWFSIDTPGGPALTRDGRFTLTETGELVTIKGYPVL
DAGGAPIQLNGGAGEIAVGADGAIHQNGVQIALLGLYEADFSKGFMRYDNSSVMPAAQPE
PVVDRFDVGVMQGFLEESNVNAIQEMSQLIMITRAFDNVTALMRDSEGSLDKAIETLGGS
R