Protein Info for SMc02889 in Sinorhizobium meliloti 1021

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 52 to 69 (18 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 345 to 367 (23 residues), see Phobius details amino acids 373 to 391 (19 residues), see Phobius details PF13000: Acatn" amino acids 20 to 157 (138 residues), 33.7 bits, see alignment E=1.6e-12 PF07690: MFS_1" amino acids 23 to 306 (284 residues), 72.7 bits, see alignment E=2.7e-24

Best Hits

KEGG orthology group: K05373, MFS transporter, putative signal transducer (inferred from 100% identity to smk:Sinme_3541)

Predicted SEED Role

"AmpG permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SY4 at UniProt or InterPro

Protein Sequence (421 amino acids)

>SMc02889 transporter (Sinorhizobium meliloti 1021)
MTGIAEHSTRATPYIVLGLLSGLYAAQSATGSMVQTALPVALRDTGVSLDRIGFLAILIM
PWALKFLWAPLVDRFGTQRNWILVCQLALIVFFGVAARLPPETHLPSLSIVLLAMAFVAA
TQDVATDSLAVHATTQETRGKASGASTGGGYLGFLIGSGLWLPIYAYAGWAASMWAMASF
IAVLTLPTLAATHIGRHASRPRGRPGFRAVLSNRPLVGGIGFLILYQCGVRLGTSMLSPF
MVDIGFPVATIGWVRGAGGAVVGLIGALAGAALVQRFGSGRTLAAFAAVNLLAFAGLALF
AFGIWQGDIAAIVLLLVQAAAVAMSFVALYAMMMNWSDTEQAATDFAVLQSLDAALAVAM
GVIAGVIAQHAGYGVVFAATALLLAFAAWRSLRRARSIAILLPRHSSTAVVPSLPVQESR
P