Protein Info for SMc02878 in Sinorhizobium meliloti 1021

Annotation: N-acetylglucosamine-6-phosphate deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 TIGR00221: N-acetylglucosamine-6-phosphate deacetylase" amino acids 3 to 380 (378 residues), 299.1 bits, see alignment E=2.3e-93 PF01979: Amidohydro_1" amino acids 54 to 383 (330 residues), 81.5 bits, see alignment E=7.1e-27

Best Hits

Swiss-Prot: 38% identical to NAGA_VIBCH: N-acetylglucosamine-6-phosphate deacetylase (nagA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01443, N-acetylglucosamine-6-phosphate deacetylase [EC: 3.5.1.25] (inferred from 100% identity to smk:Sinme_3530)

MetaCyc: 38% identical to N-acetylglucosamine-6-phosphate deacetylase subunit (Vibrio cholerae non-O1)
N-acetylglucosamine-6-phosphate deacetylase. [EC: 3.5.1.25]

Predicted SEED Role

"N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SZ2 at UniProt or InterPro

Protein Sequence (386 amino acids)

>SMc02878 N-acetylglucosamine-6-phosphate deacetylase (Sinorhizobium meliloti 1021)
MTAKKTISGARIFDGIDWHDGAALVIEAGHVKAIAPAGSVPAGGETIDARGLLLVPGFID
LQVNGGGGALLNEKPSLESIRQICAAHAQFGTTALLPTLITDTRAVRTAAIAAGIEAKAA
AVPGFLGLHLEGPHLSVARKGAHDPALIRPMGDDDLAEILACAKALSRLMLTVAPENATK
EQVRALADAGVVVSLGHTDVDYDTACAYAKAGARTVTHLFNAMSGLGHREPGVVGAALST
GTLHAGMIADGFHVHPASMGIALRGKKGPGQIFLVTDAMSPIGTDQTSFFLNGREILRQG
GRLTLADGTLAGADVDMLSSVRFVHQKLGLPIEEAVRMASAYPADAMGIASHKGRLLPGT
DADFVLLTPELAMKSTWIGGETVFAA