Protein Info for SMc02866 in Sinorhizobium meliloti 1021

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF00440: TetR_N" amino acids 15 to 61 (47 residues), 65.3 bits, see alignment 3.4e-22 PF08361: TetR_C_2" amino acids 95 to 194 (100 residues), 34.4 bits, see alignment E=2.1e-12

Best Hits

Swiss-Prot: 37% identical to BEPR_BRUSU: HTH-type transcriptional repressor BepR (bepR) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K03577, TetR/AcrR family transcriptional regulator, acrAB operon repressor (inferred from 100% identity to sme:SMc02866)

Predicted SEED Role

"Transcription repressor of multidrug efflux pump acrAB operon, TetR (AcrR) family" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92T04 at UniProt or InterPro

Protein Sequence (216 amino acids)

>SMc02866 transcriptional regulator (Sinorhizobium meliloti 1021)
MRRTKADAEATRQKILCAAERMFYKKGVPNTTLEEVAKEAGVTRGAIYWHFANKTDLFLA
LYEAVPLPHEDMIAREIETEAFDTLAIVESATSDWLTTLAADEQRQRILAIMLRCDYDND
MSAVLVRQREIEERHDALLELAFARALERGQLQEHWAPPTAARALRWMMMGLCTEWLLFG
RRFDLVAQGSEALQSLFAGFRRVPARGDTSSRLGPN