Protein Info for SMc02822 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details PF00482: T2SSF" amino acids 188 to 316 (129 residues), 67.4 bits, see alignment E=6e-23

Best Hits

KEGG orthology group: K12511, tight adherence protein C (inferred from 100% identity to sme:SMc02822)

Predicted SEED Role

"Type II/IV secretion system protein TadC, associated with Flp pilus assembly" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92T37 at UniProt or InterPro

Protein Sequence (327 amino acids)

>SMc02822 hypothetical protein (Sinorhizobium meliloti 1021)
MAGWIETLTDPNILVAALVSMAVLATFYSLVAPLLERGDLAKRMKSVATEREQIRARERA
RLNAEATTGRASLRAQHNTSVREIVERLNLRKALVDDNTVNRLKTAGYRSQNALNTFLFA
RFCLPFLFLTVAVLYIFVLGNFADKPIMVRVSFAIGFAYVGFYAPNIFIANAISKRQQSI
RRAWPDALDLLLICVESGVSMELAMRRVADEIAVQSPPLAEELVLTTAELSFLPERRIAL
ENLGLRTGLDEVKSVTQALIQADRYGTPVAQALRVLAQESRDQRMTAAEKKAAALPPKLT
VPMILFFLPVLVAVILGPAGIQVADKF