Protein Info for SMc02798 in Sinorhizobium meliloti 1021

Annotation: tRNA uridine 5-carboxymethylaminomethyl modification protein GidA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 623 TIGR00136: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA" amino acids 4 to 614 (611 residues), 804.4 bits, see alignment E=3.2e-246 PF01134: GIDA" amino acids 5 to 392 (388 residues), 554.4 bits, see alignment E=4.7e-170 PF12831: FAD_oxidored" amino acids 5 to 35 (31 residues), 28 bits, see alignment (E = 4.4e-10) PF00890: FAD_binding_2" amino acids 5 to 35 (31 residues), 20.7 bits, see alignment (E = 6.6e-08) PF21680: GIDA_C_1st" amino acids 456 to 547 (92 residues), 64.3 bits, see alignment E=4.5e-21 PF13932: SAM_GIDA_C" amino acids 551 to 618 (68 residues), 74.6 bits, see alignment E=1.6e-24

Best Hits

Swiss-Prot: 100% identical to MNMG_RHIME: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (mnmG) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03495, glucose inhibited division protein A (inferred from 100% identity to smk:Sinme_3328)

Predicted SEED Role

"tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92KW2 at UniProt or InterPro

Protein Sequence (623 amino acids)

>SMc02798 tRNA uridine 5-carboxymethylaminomethyl modification protein GidA (Sinorhizobium meliloti 1021)
MTDYDVIVIGGGHAGCEAASASARLGARTVLITHKMDTIGVMSCNPAIGGLGKGHLVREI
DALDGLMGRVADAAGIQFRLLNRRKGPAVRGPRTQADRKLYREAMQREISGIENLSVIEG
DAFDLLTEDGVVCGTAMKDGRIFRAAAVVLTTGTFLKGLIHIGQRKIPAGRVGEEPSLGL
SGTLRRFGLQLGRLKTGTPARLDGRTIDWDRVGRQGPDENPVPFSFMTDAIINRQIDCGV
TRTTDATHKIIADNIHQSAMYSGQIEGVGPRYCPSIEDKIVRFGERDGHQIFLEPEGLDD
DTVYPNGISTSLPEDVQDAFIRTIPGLEQVKILQPGYAIEYDHVDPRELELSLGVRKMPG
LFLAGQINGTTGYEEAGAQGLVAGLNAALRSIGRAPHFFSRTDSYIGVMIDDLTSRGITE
PYRMFTSRAEYRLSLRADNADMRLTPAGITLGCVGDARRQRFEAWKHSYETGRTLLQSLS
VTPSEGKRFGLKLNQDGQRRTAFDILSYPDQSIAALKPLWPELQTIPAGVVEALEIDAAY
AVYMERQATDIAGVRRDENTSIPDDFDYEVLPGLSNELKQKLAQHKPRNLAQAMKVDGVT
PAAISLILSWLRRQVRQAQRVGG