Protein Info for SMc02771 in Sinorhizobium meliloti 1021

Annotation: zinc-type alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF08240: ADH_N" amino acids 25 to 130 (106 residues), 107 bits, see alignment E=9e-35 PF16912: Glu_dehyd_C" amino acids 149 to 333 (185 residues), 39.1 bits, see alignment E=1.2e-13 PF00107: ADH_zinc_N" amino acids 170 to 295 (126 residues), 68.8 bits, see alignment E=9.3e-23 PF13602: ADH_zinc_N_2" amino acids 216 to 300 (85 residues), 28.5 bits, see alignment E=5.7e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3354)

Predicted SEED Role

"Sorbitol dehydrogenase (EC 1.1.1.14)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.14

Use Curated BLAST to search for 1.1.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TD4 at UniProt or InterPro

Protein Sequence (338 amino acids)

>SMc02771 zinc-type alcohol dehydrogenase (Sinorhizobium meliloti 1021)
MKAVVCSEPGRLALVARSGPEAPPPGSVRLAVSRVGICGTDYHIFEGKHPFLEYPRVMGH
EISARVIEGGPGTRLAPGTLVVVNPYLSCGECIACRKGKPNCCTAIRVLGVHTDGAFCEE
IVMPEQNLYPAEGLSPEAAAAVEFLAIGAHAVRRSAAGRGVRSLVIGAGPIGLGTAVFSR
IAGHDVRLLDTSEERLAFATEKLGFSPGILAGDDAALAQATGGDGFDVVFDATGNAQSME
RAFGHVAHGGTLVFVSVVKEEIRFSDPEFHKREMTLVASRNATREDFDHVIQSLAAGLVP
IEALVTHRTTLEDLVRDLPRWVHDKSGLVKAVVAVSAG