Protein Info for SMc02761 in Sinorhizobium meliloti 1021

Annotation: thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 PF00085: Thioredoxin" amino acids 3 to 103 (101 residues), 121.5 bits, see alignment E=3.6e-39 TIGR01068: thioredoxin" amino acids 7 to 105 (99 residues), 135 bits, see alignment E=4.5e-44 PF13098: Thioredoxin_2" amino acids 13 to 103 (91 residues), 36 bits, see alignment E=1.9e-12 PF00578: AhpC-TSA" amino acids 18 to 67 (50 residues), 27.7 bits, see alignment E=5.8e-10 PF13905: Thioredoxin_8" amino acids 21 to 62 (42 residues), 27.1 bits, see alignment E=1.1e-09 PF14595: Thioredoxin_9" amino acids 23 to 88 (66 residues), 28.6 bits, see alignment E=2.8e-10

Best Hits

Swiss-Prot: 76% identical to THIO1_CORNE: Thioredoxin C-1 from Corynebacterium nephridii

KEGG orthology group: K03671, thioredoxin 1 (inferred from 98% identity to smd:Smed_3241)

MetaCyc: 56% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"FIG149041: Thioredoxin"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TC5 at UniProt or InterPro

Protein Sequence (107 amino acids)

>SMc02761 thioredoxin (Sinorhizobium meliloti 1021)
MATVKVDTANFQKEVLNSAEPVVVDFWAEWCGPCKMIAPSLEEIATELAGKVKVVKLNID
ENPELAAQYGVRSIPTLAMFKGGEVADIKVGAAPKTALSSWISNAVA