Protein Info for SMc02754 in Sinorhizobium meliloti 1021

Annotation: phosphocarrier HPr

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 96 transmembrane" amino acids 54 to 73 (20 residues), see Phobius details PF00381: PTS-HPr" amino acids 10 to 89 (80 residues), 91.5 bits, see alignment E=1.5e-30 TIGR01003: phosphocarrier, HPr family" amino acids 10 to 88 (79 residues), 93.5 bits, see alignment E=3e-31

Best Hits

Swiss-Prot: 49% identical to PTHP_NEIMA: Phosphocarrier protein HPr (ptsH) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K11189, phosphocarrier protein (inferred from 100% identity to sme:SMc02754)

Predicted SEED Role

"Phosphocarrier protein, nitrogen regulation associated"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TC0 at UniProt or InterPro

Protein Sequence (96 amino acids)

>SMc02754 phosphocarrier HPr (Sinorhizobium meliloti 1021)
MDHRPDTALTRELLIVNKRGLHARASAKFVQTVETFDAEITVSKDGMTVGGTSIMGLMML
AASTGCSVFVTASGAQAEEALNALDRLVRDRFGEEM