Protein Info for SMc02726 in Sinorhizobium meliloti 1021

Annotation: iron transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 743 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF07715: Plug" amino acids 69 to 175 (107 residues), 47.5 bits, see alignment E=3.5e-16 TIGR01786: TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein" amino acids 70 to 743 (674 residues), 398.6 bits, see alignment E=5.6e-123 TIGR01785: TonB-dependent heme/hemoglobin receptor family protein" amino acids 72 to 743 (672 residues), 389 bits, see alignment E=4.4e-120 PF00593: TonB_dep_Rec" amino acids 285 to 701 (417 residues), 218.5 bits, see alignment E=5.1e-68 PF14905: OMP_b-brl_3" amino acids 480 to 708 (229 residues), 37 bits, see alignment E=3.4e-13

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to sme:SMc02726)

Predicted SEED Role

"TonB-dependent hemin , ferrichrome receptor" in subsystem Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92N43 at UniProt or InterPro

Protein Sequence (743 amino acids)

>SMc02726 iron transport protein (Sinorhizobium meliloti 1021)
MLNRHHRLALLACTAAIFALPIPPVLAQSAPTETAAEGNANTTVLKKIVAKGDRLAGAQR
GGIADTPLATEIDAKTLEEKQVTDLDDLGRSVDAGINASRADFGINLRGLSGPRIVTTID
GVPIPYISNSARQGAFASINANGGGDMFDFNSLSVVDIVRGADSSRGGSGMLGGAVVLRT
LEPEDVISDGKDWGAIFRSIYDSEDDSIAGSVAGAHRFGQTSVLFQGSYRKGNERDNEGT
VGGYGSARTEPNPTDFDQNNLLFKFRHELEGGHRIGLTAESFRRDADNDLRAEQGRRYKI
GDYTGFEDRDRKRVSLDYDFEAASSDDFFSFARASLYWQDLERSSGSNGRTIADVPYGRD
NSISNESVGFNGRAGKDFETGGFDHSLTFGLDVARSEWSQYTSAVCPTPATCPALNNQSE
VPDVRSMTVGAILEDRISVGDSAFALTPGLRFDWFQYDPQLNAGFESNTGSGIFGDLKAR
DGVRLSPKLLATYDVTPDVELFAQWSMAFRAPTVDELYSRFYNPFGNYAQLGNPDLKPET
GKGFEIGANFDTGELSGRVAAFHNIYDNFIETGDSINSDTGIREFKYANVNKARISGIEL
SALKTFDNGFNLHASLAYSYGKNEDEGTRLRTVAPFKAIIGGGYSQETFGVDVSTTVSAA
MPDDNDSETFDAPGYGLVDMTGWWTPESFKGLRVEAGVYNIFDKKYFNALGVRGVDLASS
SAQPRDFYSEPGRTFKVSLTQRF