Protein Info for SMc02571 in Sinorhizobium meliloti 1021

Annotation: toxin secretion transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 11 to 440 (430 residues), 451.1 bits, see alignment E=2e-139 PF25917: BSH_RND" amino acids 56 to 321 (266 residues), 40.6 bits, see alignment E=1.9e-14 PF26002: Beta-barrel_AprE" amino acids 328 to 417 (90 residues), 52.5 bits, see alignment E=4.4e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_0895)

Predicted SEED Role

"RTX toxin transporter, determinant D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92R29 at UniProt or InterPro

Protein Sequence (440 amino acids)

>SMc02571 toxin secretion transmembrane protein (Sinorhizobium meliloti 1021)
MKEAVIERPVSPTVRLTTWVLISGLVAIFVGGYWLKIEIVARGQGKVIPVSRVQLVQPQT
NGRIIRILVTEGQPVKAGDLLVGMDTVSVESQIKLRLTEVRRQRRGATVARVIIAALTNV
AVANDDVLAAGRAAFERERHDLEVIDGAEALIEAVLTSLRDQVARINAQLDRVEQSRITQ
QARLQKARSDLDISSRKFLSAGKLKDKGAISEVDYFERLREQRARELEVLISESELNILA
AEANALARQRQSIISTAVENYQKQLNEASTSLAGLEAELSAARNQLALLAIRAPADGKVE
NLTVFTIGGFVEAGSTLMSIVPSGDGMEIEAFFDNRDIGFLAKGQEAFVKFDAFPAERFG
IVRGRVTRVGADARGDIVPGKWVYAIHLVLDQETIGIGGRDIGFSPGMTATIDVITGERR
LISYFFEPIIKAIQDGLGER