Protein Info for SMc02560 in Sinorhizobium meliloti 1021

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF00072: Response_reg" amino acids 4 to 113 (110 residues), 101.1 bits, see alignment E=4.2e-33 PF00486: Trans_reg_C" amino acids 161 to 236 (76 residues), 80 bits, see alignment E=1.1e-26

Best Hits

Swiss-Prot: 100% identical to CHVI_RHIME: Transcriptional regulatory protein ChvI (chvI) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K14981, two-component system, OmpR family, response regulator ChvI (inferred from 100% identity to sme:SMc02560)

Predicted SEED Role

"DNA-binding response regulator ChvI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P50350 at UniProt or InterPro

Protein Sequence (240 amino acids)

>SMc02560 transcriptional regulator (Sinorhizobium meliloti 1021)
MQTIALVDDDRNILTSVSIALEAEGYKVETYTDGASALEGLLARPPQLAIFDIKMPRMDG
MELLRRLRQKSDLPVIFLTSKDEEIDELFGLKMGADDFITKPFSQRLLVERVKAILRRAA
NREAAAGGTGPAKNADTPSRSLERGQLVMDQERHTCTWKNESVTLTVTEFLILHALAQRP
GVVKSRDALMDAAYDEQVYVDDRTIDSHIKRLRKKFKMVDNDFDMIETLYGVGYRFRETA