Protein Info for SMc02507 in Sinorhizobium meliloti 1021

Annotation: iron transport system membrane ABC transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 13 to 37 (25 residues), see Phobius details amino acids 57 to 82 (26 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 124 to 149 (26 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details PF00950: ABC-3" amino acids 11 to 265 (255 residues), 270.8 bits, see alignment E=1.3e-84 PF01032: FecCD" amino acids 65 to 263 (199 residues), 34.1 bits, see alignment E=1.6e-12

Best Hits

Swiss-Prot: 69% identical to YFEC_YERPE: Chelated iron transport system membrane protein YfeC (yfeC) from Yersinia pestis

KEGG orthology group: K11605, manganese/iron transport system permease protein (inferred from 100% identity to smk:Sinme_3081)

Predicted SEED Role

"Manganese ABC transporter, inner membrane permease protein SitC" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LL3 at UniProt or InterPro

Protein Sequence (285 amino acids)

>SMc02507 iron transport system membrane ABC transporter protein (Sinorhizobium meliloti 1021)
MIATLIEPFAYSYMVNAMWVSALVGAVCAFLSAYLMLKGWSLIGDALSHSIVPGVAGAYM
LGLPFSLGAFFSGALAAGAMLFLNQRTRLKEDTIIGLIFTSFFGLGLFMVSLSPTSVNIQ
TIVLGNILAITPADTLQLAIIGVVSLMILSAKWKDLMVTFFDESHARSIGINTTFLKVLF
FTLLSASTVAALQTVGAFLVVAMVVTPGATAYLLTDRFPRLIVISIAIGALTSFVGAYAS
YFLDGATGGIIIVLQTAIFLFAFVLAPKHGLLAARRRASEALETA