Protein Info for SMc02489 in Sinorhizobium meliloti 1021

Annotation: site-specific tyrosine recombinase XerC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 PF02899: Phage_int_SAM_1" amino acids 37 to 122 (86 residues), 54.2 bits, see alignment E=1.5e-18 PF00589: Phage_integrase" amino acids 165 to 316 (152 residues), 113.3 bits, see alignment E=1.1e-36

Best Hits

Swiss-Prot: 100% identical to XERC_RHIME: Tyrosine recombinase XerC (xerC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 100% identity to smk:Sinme_3099)

Predicted SEED Role

"Tyrosine recombinase XerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LK1 at UniProt or InterPro

Protein Sequence (330 amino acids)

>SMc02489 site-specific tyrosine recombinase XerC (Sinorhizobium meliloti 1021)
MLRAWISELTALMKPPGPMMNELLAIGHPEVMAERRRWLASLAEERRLSEKTVDAYERDT
RQFLTFLTGHLAGPPRLSDICALRPADLRGFLAQRRKGGAGARTLGRGLAGLRSFLRYLE
RNGLANAAGAGAVRSPKQPKSLPKALTDREALKVVTADAQLAEEPWIAARNAAVLTLLYG
CGLRIAEALDLTPADFSGPVTSLRVTGKGGKTRIVPMIAAAAEAVETYRKLCPYHIEPEE
PIFRGARGAKLQPAIIQREMQKLRAALGLPDSATPHALRHSFATHLLAGGGDLRTIQELL
GHASLSTTQVYTGVDSARLLEIYDRAHPRA