Protein Info for SMc02474 in Sinorhizobium meliloti 1021

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF00005: ABC_tran" amino acids 20 to 161 (142 residues), 117.9 bits, see alignment E=8.1e-38 PF17912: OB_MalK" amino acids 235 to 286 (52 residues), 45.7 bits, see alignment 1.5e-15 PF08402: TOBE_2" amino acids 279 to 347 (69 residues), 25.5 bits, see alignment E=1.8e-09

Best Hits

Swiss-Prot: 54% identical to UGPC_CHRVO: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3114)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LJ1 at UniProt or InterPro

Protein Sequence (356 amino acids)

>SMc02474 ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MASVELRDIRKSYAALEVVHGVSLSIAEGEFIALVGPSGCGKSTLLRMIAGLEEISDGEV
LIGGKVVNPLTPRERNIAMVFQSYALYPHMSVAENMGFNLKLSGLSRPEIDKKVGEAARM
LALTELLDRKPSQLSGGQRQRAAMGRAIVRDPAVFLFDEPLSNLDAKLRVQMRTEIKALH
QKVATTSIYVTHDQIEAMTLADRIVVLNGGRIEQVGTPLELYRTPANLFVAGFIGSPAMN
VLDGTVDADDGEPAVRLGDGSAIRIAPERKVRPGQAVRIGLRPEHFVAGGEGNAIAGQTL
LVEPTGAQTHVLFEFAGEQITAVVDGDHPARHGSLFRAAMDRSQVYVFDRQTGAAL