Protein Info for SMc02467 in Sinorhizobium meliloti 1021

Annotation: peptide methionine sulfoxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 25 to 171 (147 residues), 150.5 bits, see alignment E=2.4e-48 PF01625: PMSR" amino acids 26 to 171 (146 residues), 167.9 bits, see alignment E=9.7e-54

Best Hits

Swiss-Prot: 100% identical to MSRA2_RHIME: Peptide methionine sulfoxide reductase MsrA 2 (msrA2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 100% identity to smk:Sinme_3121)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.11

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LI5 at UniProt or InterPro

Protein Sequence (198 amino acids)

>SMc02467 peptide methionine sulfoxide reductase (Sinorhizobium meliloti 1021)
MLRLLFGFLVTCFLLLPARAAEPQYAIFAGGCFWCVESDFDAVPGVLETISGYAGGKSAN
PTYEDYAKGGHREVVRVKFDPDRVSYAELVGVLFRTTDPTDGDGQFCDRGFAYTTAIHAL
NERQAMDAKAEKIKAEAELGRPIVTPVEGAAKFWPAEDYHQDFGKRNPIRYWYYRNGCGR
NRTVEKLWGDRAYAGVSH