Protein Info for SMc02424 in Sinorhizobium meliloti 1021

Annotation: oligopeptide transport ATP-binding ABC transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF00005: ABC_tran" amino acids 42 to 186 (145 residues), 97.2 bits, see alignment E=1.3e-31 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 235 to 321 (87 residues), 96 bits, see alignment E=5.4e-32 PF08352: oligo_HPY" amino acids 237 to 301 (65 residues), 78.3 bits, see alignment E=4.8e-26

Best Hits

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to sme:SMc02424)

Predicted SEED Role

"Putative glutathione transporter, ATP-binding component" in subsystem Utilization of glutathione as a sulphur source

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ML4 at UniProt or InterPro

Protein Sequence (334 amino acids)

>SMc02424 oligopeptide transport ATP-binding ABC transporter protein (Sinorhizobium meliloti 1021)
MTKPLQKTPALTVDRLVKTFDVSAPWLNRVVERKPRQYLQAVNDISFTVPAGGCLSIVGE
SGCGKSTVARLVTGLHRPTSGGIRFAPGKSGAPLSAQMIFQDPYASLNPRWRVKNIIAEP
LRELKLRKTAAEVTERVEELLGIVGLSPSDGEKFPHEFSGGQRQRISIARALASEPEFLV
CDEPTSALDVSVQAQVLNLMRRLQDELGLTYLFISHDLSVVRQMSDRIAVMYLGRIVEEG
DTEELFAQPRHPYTRLLLQTIPNIEAPNRNREPASGEVPSPLKPPSGCAFHPRCPVATAR
CSKEVPEVRVLQNGTRVACHLAEDVIAERLPEAG