Protein Info for SMc02408 in Sinorhizobium meliloti 1021

Annotation: DNA-directed RNA polymerase subunit omega

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 TIGR00690: DNA-directed RNA polymerase, omega subunit" amino acids 1 to 58 (58 residues), 58.3 bits, see alignment E=3.1e-20 PF01192: RNA_pol_Rpb6" amino acids 8 to 59 (52 residues), 59.3 bits, see alignment E=1.5e-20

Best Hits

Swiss-Prot: 100% identical to RPOZ_RHIME: DNA-directed RNA polymerase subunit omega (rpoZ) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03060, DNA-directed RNA polymerase subunit omega [EC: 2.7.7.6] (inferred from 99% identity to smd:Smed_0676)

Predicted SEED Role

"DNA-directed RNA polymerase omega subunit (EC 2.7.7.6)" in subsystem RNA polymerase bacterial (EC 2.7.7.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92R52 at UniProt or InterPro

Protein Sequence (135 amino acids)

>SMc02408 DNA-directed RNA polymerase subunit omega (Sinorhizobium meliloti 1021)
MARVTVEDCIDKVENRFELVLLASHRARLVSQGAPITVDRDNDKNPVVALREIADETLSP
GDLKEDLIHSLQKHVEVDEPEPDPASLVQTEAAPAFAEAAEEEDQPEALTFDRMSEEELL
AGIEGLVPPEKSDDY