Protein Info for SMc02396 in Sinorhizobium meliloti 1021

Annotation: outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02530: Porin_2" amino acids 24 to 331 (308 residues), 364.9 bits, see alignment E=2.9e-113

Best Hits

Swiss-Prot: 74% identical to Y4FJ_SINFN: Putative outer membrane protein y4fJ (NGR_a03720) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_0848)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92R60 at UniProt or InterPro

Protein Sequence (345 amino acids)

>SMc02396 outer membrane protein (Sinorhizobium meliloti 1021)
MNIKSLLLGSAAALAAVSGAQAADAIVAAEPEPMEYVRVCDAFGTGYFYIPGTETCLKIG
GFIRIQGEFGRDEADDRWNQEDFGGQSTSDWDMFSRAYISIDAKSDTEYGTLTGFFAAEF
NADNDTDEGDSLIDVDEAYIQLGGFKAGFFYSWWDKGLNGETDSLGNVTEFNSLAYIYDG
GTFQAGISVDELEGTSTKANGVGVTGIVSATLGGVAFDLLGSYDTEWEEGAVRGLLSADL
GPGTLQVAGIWASNPNAYWADSEWTVAASYRFNASDKFAITPAAQYWGSLQDSNTSFGND
DQWRVGITTDYDITEGLATRFTINYTDPDDGDEYVSGFLRLQRDF