Protein Info for SMc02387 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 31 to 49 (19 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details PF02694: UPF0060" amino acids 6 to 106 (101 residues), 109.1 bits, see alignment E=6.7e-36

Best Hits

Swiss-Prot: 100% identical to Y1043_RHIME: UPF0060 membrane protein R01043 (R01043) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K09771, hypothetical protein (inferred from 100% identity to sme:SMc02387)

Predicted SEED Role

"Protein of unknown function UPF0060"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92R68 at UniProt or InterPro

Protein Sequence (106 amino acids)

>SMc02387 hypothetical protein (Sinorhizobium meliloti 1021)
MPAYAIYFLAALAEITGCFAFWSWLRLGKSALWLIPGMASLALFAWLLTMVDAAAAGRTY
AAYGGVYIVASLSWLWLAEGVRPDHWDMTGAAVALAGSAIILAGPR