Protein Info for SMc02344 in Sinorhizobium meliloti 1021

Annotation: periplasmic binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 41 to 333 (293 residues), 343.8 bits, see alignment E=3.8e-107 PF13379: NMT1_2" amino acids 41 to 265 (225 residues), 37.3 bits, see alignment E=5.6e-13 PF12974: Phosphonate-bd" amino acids 65 to 215 (151 residues), 43.8 bits, see alignment E=4.1e-15 PF09084: NMT1" amino acids 66 to 266 (201 residues), 81.5 bits, see alignment E=1.7e-26

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to smk:Sinme_2623)

Predicted SEED Role

"putative sulfonate binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MP1 at UniProt or InterPro

Protein Sequence (344 amino acids)

>SMc02344 periplasmic binding protein (Sinorhizobium meliloti 1021)
MTSPSIRPLRRTLLKLALALSILPIAGLAPASAGEAKPDAIRIGSTAPGHLKFILYRHKK
LLEDEFSKEGIKIELTTFDGGSAATVALGSGALDFTYIGNNPSLRLAATGADVKLIGLSS
WNRSNETQIVVKPDSPIRKIEDLKGKKVAYLSGTVRHSTFAKALKAAGLSIGDVESLNLG
IESSGPALARGDVDAIVESTGPVQKLVEEGQARVIFDAGVSGSPEWAVPHLISVNGDFAR
KYPQIVARLLAVDVAAARWADANPEETIAIFVKETGNSDMAVRATYPNGKFYQDPEITDA
AVRALQGEEAFMADAGLLKGKVDYRTWIDRSFYEAAIKRLAASN