Protein Info for SMc02324 in Sinorhizobium meliloti 1021

Annotation: periplasmic binding ABC transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 27 to 231 (205 residues), 22.6 bits, see alignment E=6.7e-09 TIGR02637: rhamnose ABC transporter, rhamnose-binding protein" amino acids 29 to 327 (299 residues), 476.7 bits, see alignment E=1.5e-147 PF13407: Peripla_BP_4" amino acids 29 to 285 (257 residues), 225.1 bits, see alignment E=1.2e-70

Best Hits

Swiss-Prot: 34% identical to LSRB_YERPG: Autoinducer 2-binding protein LsrB (lsrB) from Yersinia pestis bv. Antiqua (strain Angola)

KEGG orthology group: K10559, rhamnose transport system substrate-binding protein (inferred from 100% identity to sme:SMc02324)

Predicted SEED Role

"Predicted L-rhamnose ABC transporter, substrate-binding component" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92S11 at UniProt or InterPro

Protein Sequence (329 amino acids)

>SMc02324 periplasmic binding ABC transporter protein (Sinorhizobium meliloti 1021)
MKVLKSLMVTAAVAVALMANAAHAENKKIALVVKALGIGFFEAANKGAQEAAKELGDVEI
IYTGPTSTTAEGQIEVINSLIAQKVDAIAVSANDTDALVPALKKAMDRGIKVISWDSGVA
KEGRLMHLNPSSSPLIGNMIIKLAADNLPEGGDVAVLSASATATNQNTWIAEMKKVQGNY
KGINVVATVYGDDLADKSYRETQGLIQSHPNLKAIIAPTSVGIVAAAQAVTDAGKIGQIN
VTGLGLPSEMAGHVKSGASKSFAIWNPIDLGYSATMIAYDLINGAEAKPGAELKMGRMGT
VKLDENNEGAMADPFVYDASNVEEFAKIF