Protein Info for SMc02252 in Sinorhizobium meliloti 1021

Annotation: UDP-glucose 4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 1 to 159 (159 residues), 45.1 bits, E=2.9e-15
• TIGR01179: UDP-glucose 4-epimerase GalE
  • amino acids 2 to 326 (325 residues), 416.2 bits, E=3.9e-129
• PF05368: NmrA
  • amino acids 3 to 119 (117 residues), 25.4 bits, E=3.6e-09
• PF01370: Epimerase
  • amino acids 3 to 253 (251 residues), 191.4 bits, E=7.1e-60
• PF02719: Polysacc_synt_2
  • amino acids 3 to 175 (173 residues), 56.9 bits, E=7.8e-19
• PF01073: 3Beta_HSD
  • amino acids 4 to 168 (165 residues), 56.9 bits, E=6.9e-19
• PF16363: GDP_Man_Dehyd
  • amino acids 4 to 315 (312 residues), 162.7 bits, E=6.7e-51
• PF07993: NAD_binding_4
  • amino acids 65 to 193 (129 residues), 26.1 bits, E=1.8e-09

Best Hits

Swiss-Prot: 56% identical to EXOB_AZOBR: UDP-glucose 4-epimerase (exoB) from Azospirillum brasilense

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 99% identity to smk:Sinme_0199)

MetaCyc: 46% identical to UDP-glucose-4-epimerase (Streptococcus thermophilus)
UDP-glucose 4-epimerase. [EC: 5.1.3.2]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• stachyose degradation (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• colanic acid building blocks biosynthesis (6/11 steps found)
• UDP-sugars interconversion (4/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

See Q92S70 at UniProt or InterPro

Protein Sequence (342 amino acids)

>SMc02252 UDP-glucose 4-epimerase (Sinorhizobium meliloti 1021)
MAVLVTGGAGYIGSHMVWSLLDGGEAVVVLDCLSTGFRWAVAPEARFYFGDVGDRALLQR
VFAENEIDSVVHFAGSAVVPESVANPLAYYENNTANTRTLIAATVEAGIRHFVFSSTAAV
YGTQDTPDPVSETAALRPQSPYGRSKLMSEMMLQDAAAAHDFRFVALRYFNVAGADPLGR
AGQSTLGATHLIKVACEAALGRRRKIDVLGTDYPTADGTGVRDYIHVSDLVAAHRSALAY
LRAGGEPLVANCGYGHGFSVLQVLDTVRQVSGRDFMVDYAPRRPGDPAQIVADPSVARLK
LDWVPTHASLEHIVRSAFDWESHLSRKNSFDEEQDERLIANG