Protein Info for SMc02232 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 44 to 45 (2 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 171 to 200 (30 residues), see Phobius details amino acids 207 to 232 (26 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details PF01925: TauE" amino acids 18 to 287 (270 residues), 176 bits, see alignment E=5.3e-56

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to sme:SMc02232)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92S85 at UniProt or InterPro

Protein Sequence (308 amino acids)

>SMc02232 hypothetical protein (Sinorhizobium meliloti 1021)
MTVYLPIAELSVNIFIILGMGAAVGFLSGMFGVGGGFLITPLLIFYNIPPVVAVATGANQ
VVASSISGAIAHFRRGTIDIKLGTVLLCGGLVGATVGVWLFSLLRSIGQLDLVISLLYVV
LLGSVGALMLWESIGAMRKAAKNQPAQLRRPGQHNWIHGLPLKMRFKKSKIYLSVIPVAT
LGFSIGVLTSVMGVGGGFIMVPAMIYLLRIPTSVVVGTSLFQIVFVSAYTVIVQASTNYT
VDIVLAFVLMIAGVIGAQYGVRVGQRLRGEQLRALLALLVLAVGIRLAVELVIPPKDIYS
VVSAAAGF