Protein Info for SMc02224 in Sinorhizobium meliloti 1021

Annotation: calcium/proton antiporter transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 34 to 52 (19 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 213 to 238 (26 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 280 to 304 (25 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details amino acids 341 to 360 (20 residues), see Phobius details PF01699: Na_Ca_ex" amino acids 36 to 184 (149 residues), 50.4 bits, see alignment E=1.2e-17 amino acids 216 to 357 (142 residues), 31.6 bits, see alignment E=7.7e-12

Best Hits

KEGG orthology group: K07300, Ca2+:H+ antiporter (inferred from 100% identity to smk:Sinme_0173)

Predicted SEED Role

"Calcium/proton antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92S90 at UniProt or InterPro

Protein Sequence (361 amino acids)

>SMc02224 calcium/proton antiporter transmembrane protein (Sinorhizobium meliloti 1021)
MLAKLRSERHLVAAFLAALAGVAVEHHLLEAGRAASLIGAALMVAAIVLASMRVAHHAEV
LAAKVGDPYGTMILTLSAVLVEVVILAIMMTGETSPTLVRDTIYSAVMLDINGILGLAAL
LGGLKHGEQPYNDDSARTYSVMILTAMGISMLVPEFVPQSKWHYYSAFTIGAMIVLYTLF
LRMQVGVHSYFFSYSYPRAKAGTAASRLEGEPVLPSVVVLILGVVVIGFLAEIMSGLLSA
GIKGTAAPPALAAIVVAAISASPEVMTAMRAALANRMQAVVNIALGASLSTVILTVPVME
AIALYTGQPFIMAMSPVQTVMVAVTLIAAAINLNDGQTNAIEGMTHFVLFATFIMLSALG
L