Protein Info for SMc02123 in Sinorhizobium meliloti 1021

Updated annotation (from data): required for sulfate utilization, putative electron transport protein for sulfite reductase
Rationale: PFam PF06073.8 (DUF934). conserved cofitness with sulfite reductase (SMc02124, sometimes misannotated as nitrite reductase); auxotrophic
Original annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF06073: DUF934" amino acids 51 to 152 (102 residues), 112.6 bits, see alignment E=4.1e-37

Best Hits

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_1273)

Predicted SEED Role

"Oxidoreductase probably involved in sulfite reduction"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Q77 at UniProt or InterPro

Protein Sequence (166 amino acids)

>SMc02123 required for sulfate utilization, putative electron transport protein for sulfite reductase (Sinorhizobium meliloti 1021)
MTKIWKETGFVNDDPWVIETDETKAGSNEKAILNIDGFLAAVAESDASELGVLINPADDV
MRLQPYLERIALVAVAFPAFSDGRSFSHASLLRSRLGYQGEIRAVGDVLIDPIPLMLRCG
VDSFAVTNATAIKRLSEGRLPGISNHYQPTAKPSANINSYSWRRVS