Protein Info for SMc02096 in Sinorhizobium meliloti 1021

Annotation: phosphatidate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 12 to 43 (32 residues), see Phobius details amino acids 59 to 75 (17 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details PF01148: CTP_transf_1" amino acids 7 to 255 (249 residues), 190.7 bits, see alignment E=4.7e-60 PF01864: CarS-like" amino acids 163 to 251 (89 residues), 28.4 bits, see alignment E=1.5e-10

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 100% identity to sme:SMc02096)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.41

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Q50 at UniProt or InterPro

Protein Sequence (277 amino acids)

>SMc02096 phosphatidate cytidylyltransferase (Sinorhizobium meliloti 1021)
MQAELKLRIASGLVLAAVVLAATWIGGFAFQLLSVAIGLLVYYEWSTITKLPERDFQGNA
LGWLAQVVIAGLVLLDYMHISLPGLALCVLAAALWVLIKGTSWWLPGGIVYAGLTSISLA
AIRGADYLGLMAMLFVFAVVWATDIFAYFTGRAIGGPKLAPAISPGKTWSGAIGGAIFGV
LAGVAVFMAHFSLEDLRIPVIALVLSVASQIGDLFESFVKRRFGVKDSSRLIPGHGGVMD
RVDGLIFACIAALALVLGQFLLAGGREVAFGAILLGL