Protein Info for SMc02092 in Sinorhizobium meliloti 1021

Annotation: (3R)-hydroxymyristoyl-ACP dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01750: beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  • amino acids 12 to 147 (136 residues), 194.9 bits, E=2.6e-62
• PF07977: FabA
  • amino acids 20 to 142 (123 residues), 123 bits, E=7.5e-40
• PF03061: 4HBT
  • amino acids 73 to 138 (66 residues), 25.3 bits, E=1.6e-09

Best Hits

Swiss-Prot: 100% identical to FABZ_RHIME: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (fabZ) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02372, 3R-hydroxymyristoyl ACP dehydrase [EC: 4.2.1.-] (inferred from 98% identity to rhi:NGR_c13430)

Predicted SEED Role

"3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)" (EC 4.2.1.59)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• palmitate biosynthesis III (28/29 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (18/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• 8-amino-7-oxononanoate biosynthesis I (8/11 steps found)
• stearate biosynthesis IV (4/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (3/5 steps found)
• biotin biosynthesis I (9/15 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (21/205 steps found)
• superpathway of mycolate biosynthesis (22/239 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-, 4.2.1.59

Use Curated BLAST to search for 4.2.1.- or 4.2.1.59

Sequence Analysis Tools

See Q92Q46 at UniProt or InterPro

Protein Sequence (154 amino acids)

>SMc02092 (3R)-hydroxymyristoyl-ACP dehydratase (Sinorhizobium meliloti 1021)
MNEAATVLGTADIQEILRLLPHRYPFLLVDRIIEIDDDNSAIGIKNVTANEPHFTGHFPE
KPIMPGVLLIEGMAQTAGAICARKTGIGSNLVYFMTIDNARFRKPVVPGDRVEFHVVKQK
QRGNIWKFHCDAKVDGQLVAEADIGAMIVSKEDA