Protein Info for SMc02091 in Sinorhizobium meliloti 1021

Annotation: UDP-N-acetylglucosamine acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00132: Hexapep
  • amino acids 2 to 33 (32 residues), 28 bits, 1.3e-10
  • amino acids 17 to 50 (34 residues), 33.9 bits, 1.8e-12
• TIGR01852: acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase
  • amino acids 8 to 261 (254 residues), 349.4 bits, E=5e-109
• PF13720: Acetyltransf_11
  • amino acids 180 to 259 (80 residues), 63.7 bits, E=1.8e-21

Best Hits

Swiss-Prot: 100% identical to LPXA_RHIME: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00677, UDP-N-acetylglucosamine acyltransferase [EC: 2.3.1.129] (inferred from 100% identity to smk:Sinme_1308)

MetaCyc: 48% identical to acyl-[acp]--UDP-3-acetamido-2-amino-2,3-dideoxy-alpha-D-glucopyranose N-acyltransferase monomer (Brucella abortus 2308)
RXN2B4Q-48 [EC: 2.3.1.305]

Predicted SEED Role

"Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (EC 2.3.1.129)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.129)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (6/6 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (11/17 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (11/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.129 or 2.3.1.305

Sequence Analysis Tools

See Q92Q45 at UniProt or InterPro

Protein Sequence (270 amino acids)

>SMc02091 UDP-N-acetylglucosamine acyltransferase (Sinorhizobium meliloti 1021)
MIASSAKIHPSSAIENGAVIGENVKIGPFCHIGPNVVLADDVEILSHVAVIGHTSVGKGT
KIFPGAVIGGDSQSVHHSALNTKLVIGENCTIREGVTMNTGTVEHGGATIVGNNNLFLAY
SHVAHDCRLGNNIILSNNVMLAGHVTVEDRAILGGGSAVHQFTRIGRQAFIGGLSAVSYD
VIPYGMLNGNPGVLSGLNVVGMTRAGIDRPAIHRVRRCYKQIFEGDGSIRANAAAIRNEY
LDCAPAIEILDFIAAESDRALSSPNRGAKG