Protein Info for SMc02082 in Sinorhizobium meliloti 1021

Annotation: outer membrane secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 27 to 434 (408 residues), 343.4 bits, see alignment E=1e-106 PF02321: OEP" amino acids 36 to 216 (181 residues), 102.1 bits, see alignment E=1.6e-33 amino acids 244 to 421 (178 residues), 64.5 bits, see alignment E=5.6e-22

Best Hits

Swiss-Prot: 50% identical to BEPC_BRUSU: Outer membrane efflux protein BepC (bepC) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K12340, outer membrane channel protein TolC (inferred from 100% identity to sme:SMc02082)

Predicted SEED Role

"Type I secretion outer membrane protein, TolC precursor" in subsystem Multidrug Resistance Efflux Pumps or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Q38 at UniProt or InterPro

Protein Sequence (456 amino acids)

>SMc02082 outer membrane secretion protein (Sinorhizobium meliloti 1021)
MVSIVRKAALWAAVSTSVLLAPHAVLAETIFGAMAKAYANNPDLNAARAGLRATDEGVPI
AKAGYRPQISASATGTLSRVDAERTGTRDFHSGQVGISITQTIFDGFQTLNNVRAAQADV
FSSRETLKANEIQILLSAAQSYANIARDQQVVSIRRQNLAFLREQLSAAQARLEVGEGTR
TDVSQAEAELANAQSLLVAAIAQLKQSEAVYVQIVGAAPTGIRQPGPATKAMPRSLDQAV
ATGLRENPQILAAQYAVDSAGYQVKSAEGTMLPGVVLQGAVSRNTGNAGQGLDDTTASVT
ARLEVPIYQGGAEYGQIRQAKEILGQQRILVDSARASVQQTVVSAHAQLESALARIRASR
SQIAAANLALEGVVEERKVGQRTTLDVLISQQDVLDAQEALAGAQRDAVVASYALLAAMG
HLTVRSQGLQVAEYRAEEHYEAVKDKWFGLRTVDGR