Protein Info for SMc02074 in Sinorhizobium meliloti 1021

Annotation: deoxyguanosinetriphosphate triphosphohydrolase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 TIGR01353: putative dGTPase" amino acids 37 to 398 (362 residues), 314.4 bits, see alignment E=8e-98 PF01966: HD" amino acids 75 to 217 (143 residues), 52.8 bits, see alignment E=4.7e-18 PF13286: HD_assoc" amino acids 306 to 396 (91 residues), 86.7 bits, see alignment E=1.2e-28

Best Hits

Swiss-Prot: 100% identical to DGTL1_RHIME: Deoxyguanosinetriphosphate triphosphohydrolase-like protein (R01522) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01129, dGTPase [EC: 3.1.5.1] (inferred from 100% identity to sme:SMc02074)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Q32 at UniProt or InterPro

Protein Sequence (405 amino acids)

>SMc02074 deoxyguanosinetriphosphate triphosphohydrolase-like protein (Sinorhizobium meliloti 1021)
MTVDRQALGFGYGEHAAYASNPWASRGRLYPEASSPTRSDFQRDRDRIVHTTAFRRLKHK
TQVFIAADGDHYRTRLTHTIEVAQIARALARALKLDEDLAEGVALVHDFGHTPFGHTGED
ALHEVLEPYGGFDHNAQSLRIVTKLERRYAEFDGLNLTWESLEGLVKHNGPLMTADGQGL
RGPVPQPILDYCALHDLELASFASLEAQVAAIADDIAYNTHDIDDGLRAGYLTFEMLEEI
PFLARLMREVHDRYPGLESSRFTHEIMRRQITAMVEDVIAVAQKRLGEVRPESAKDVRCA
GRVMATFSDEMSETDRQIKNLLMTRIYRHPEVMRVRQGAASIVTDLYRAFMDDPSLMKEH
YWIDQIAGMAEPARARHVGDYLAGMTDTFAISVHRRLFDHTPDLR