Protein Info for SMc02057 in Sinorhizobium meliloti 1021

Annotation: preprotein translocase subunit SecD/SecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 858 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 371 to 392 (22 residues), see Phobius details amino acids 398 to 419 (22 residues), see Phobius details amino acids 426 to 446 (21 residues), see Phobius details amino acids 471 to 493 (23 residues), see Phobius details amino acids 499 to 519 (21 residues), see Phobius details amino acids 558 to 578 (21 residues), see Phobius details amino acids 675 to 693 (19 residues), see Phobius details amino acids 700 to 721 (22 residues), see Phobius details amino acids 727 to 749 (23 residues), see Phobius details amino acids 778 to 796 (19 residues), see Phobius details amino acids 807 to 830 (24 residues), see Phobius details PF07549: Sec_GG" amino acids 39 to 62 (24 residues), 23.4 bits, see alignment (E = 8.2e-09) amino acids 572 to 597 (26 residues), 25.2 bits, see alignment (E = 2.3e-09) TIGR01129: protein-export membrane protein SecD" amino acids 47 to 523 (477 residues), 363.9 bits, see alignment E=1.8e-112 PF21760: SecD_1st" amino acids 164 to 219 (56 residues), 39.8 bits, see alignment 6.2e-14 PF22599: SecDF_P1_head" amino acids 240 to 353 (114 residues), 81.8 bits, see alignment E=8.4e-27 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 292 to 515 (224 residues), 202.2 bits, see alignment E=1.4e-63 amino acids 629 to 820 (192 residues), 170.2 bits, see alignment E=8.2e-54 PF02355: SecD_SecF_C" amino acids 355 to 517 (163 residues), 69 bits, see alignment E=9.6e-23 amino acids 653 to 831 (179 residues), 201.8 bits, see alignment E=1.7e-63 PF03176: MMPL" amino acids 399 to 519 (121 residues), 26.8 bits, see alignment E=6.3e-10 TIGR00966: protein-export membrane protein SecF" amino acids 577 to 823 (247 residues), 240.6 bits, see alignment E=3.2e-75

Best Hits

KEGG orthology group: K12257, SecD/SecF fusion protein (inferred from 100% identity to sme:SMc02057)

Predicted SEED Role

"Protein-export membrane protein SecD (TC 3.A.5.1.1) / Protein-export membrane protein SecF (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Q19 at UniProt or InterPro

Protein Sequence (858 amino acids)

>SMc02057 preprotein translocase subunit SecD/SecF (Sinorhizobium meliloti 1021)
MPRLSPFKNILIWLVVLAGLAFALPNLLSREQLADWPTWLPHRQVPLGLDLRGGSHIVLK
VSREDIVAERLQSTIDTIADALRQADIRYTGLSGSGQGLQFRLRDATKAPAARDALKALV
APVRQGGLFGNSIQELVYEESATSDTLRLRLTDEGIDLRVSDAVAQSIEVVRRRVGEVIA
VVPIIERRGGDRLSVQVPGLDEPQRLKDLLGQRGDVALKWLDSSMPAQQAVDTRPPAGSE
VLYSLDDPPIPYLVERRAFAAAPDFVEAQPGFDPATSEPVVNARIAAGAAARVAPFLQSD
PRKQFAIVLDGQVISTSVLDGALSGDAVRISGNLSEDGANDLAALMRAGPLPVSLTVIEE
RTVGPEDGADAVANGLTAGLIAAIAVAACMIGFYGFFGVVAVIAVIVNVVLIIAVLSVTG
ATLTLPGIAGIILTIGIAVDSNVLIYERLREEARTSGKPLRRALDDGFERVLRSIVDANL
TIFIAGAILLYLGSGAIRGFAVTLAIGSVTTILTAHSLTRRLIRGWYRRRLPQRLPRGIR
TGFFSRADFRFMAIRNPVFILMTALSLASLVLLTSLGLNMGADFRGGSVIELRARTGVAD
GADIRARLDELNLGDVQVEELGSARDVLVRIPSQEAGDNAEQTAVGLVRSELEDQYVFRR
VEVVGPGVSGELTRAGSLAVAAAVLAVLLYVWLRFGRRFAVGAIVATLHDVLLTLGFLVL
TGIEFNLASIAALLTIVCYSLSDTMVIYDRVRENLVRYRRMPLSVLIDTSINQTLSRTVL
TAVTTLLALVALYLFGGSGLVQSFSATLIFGVLVGTVSSIYVAGPLLILFNRRNNRLGGT
QDPAEPDASSETEAKGAV