Protein Info for SMc02042 in Sinorhizobium meliloti 1021

Annotation: glucose-6-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF06560: GPI" amino acids 27 to 194 (168 residues), 264 bits, see alignment E=2.3e-83

Best Hits

Swiss-Prot: 100% identical to G6PI1_RHIME: Putative glucose-6-phosphate isomerase 1 (pgiA1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06859, glucose-6-phosphate isomerase, archaeal [EC: 5.3.1.9] (inferred from 100% identity to smk:Sinme_2605)

Predicted SEED Role

"Glucose-6-phosphate isomerase, archaeal (EC 5.3.1.9)" in subsystem Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.3.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.9

Use Curated BLAST to search for 5.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MQ8 at UniProt or InterPro

Protein Sequence (214 amino acids)

>SMc02042 glucose-6-phosphate isomerase (Sinorhizobium meliloti 1021)
MTKLFEPAGCRVDLRTGAMSDATGAYQKRFRDLAGLYADEAAFSAMQETWNDTVVYEVSE
FRPNERTGDLIFGVTRMLPGKVGEEYFVTRGHIHKQSDRPEIYYGQKGRGLMLLESPEGE
VRVVAVDAQTVCYVPPYWIHRSVNIGGDELVMLFCYPADSGQDYDCIAKAGGMRARIIDD
GRGGWKQIDNPNWRMRDAATVAALYGREKKEENA