Protein Info for SMc02019 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 178 to 205 (28 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 313 to 330 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 56 to 324 (269 residues), 140 bits, see alignment E=4.3e-45

Best Hits

Swiss-Prot: 38% identical to YPHD_ECOLI: Probable ABC transporter permease protein YphD (yphD) from Escherichia coli (strain K12)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to smk:Sinme_2580)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MT0 at UniProt or InterPro

Protein Sequence (334 amino acids)

>SMc02019 ABC transporter permease (Sinorhizobium meliloti 1021)
MSEANVTMAASTPQAALGRKLVAAAANSRELSVILAALAMFVALSLSTDTFFTELNLLNL
LRQISVIGILAVGSTFIFISGEIDLSVGALLGLLAMICAALAIKMEGNIYGAALVVVALG
AILSGINGVITTKLRIPSFITTLGMLSIYSGATLVLSKGMPISGLQNDLFRSLVAGRLFG
VVPAQVIWMVAAGIFGTYLLLFTRFGYNVFATGGNKNAAKAVGINTDRVKILAFVVSGIM
VGVTSFILVGWFRGVDPQTGNGLELSVIAAVIIGGTGLFGGQGSVLGTLVGALIIGMISN
GTVLLGVDSYYEPVAHGTVILLAVIIDIWVRRQR