Protein Info for SMc01979 in Sinorhizobium meliloti 1021

Annotation: sugar transport system permease ABC transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 88 to 270 (183 residues), 76.9 bits, see alignment E=8.7e-26

Best Hits

Swiss-Prot: 36% identical to YCJP_ECOLI: Inner membrane ABC transporter permease protein YcjP (ycjP) from Escherichia coli (strain K12)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to sme:SMc01979)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MU6 at UniProt or InterPro

Protein Sequence (277 amino acids)

>SMc01979 sugar transport system permease ABC transporter protein (Sinorhizobium meliloti 1021)
MRAKQAFLTIAHRLAVLAYIAFALFPLFWLLKVAVTPNDLLYSEGIRLWPSRASLEHFDF
VLRHSAFPVFFRNSLIVSGSTAVIVTILASLSGYALSRFRFRGKYWLVTLMLLTQMFPLV
MLVAPIFKILSPLGLTNSLTGLVVVYTAFNVPFATFLMQSFFDGIPKDLEEAAMIDGATQ
FVAFRQIILPLTLPGIAATLGFVFTAAWSELLFSLMLISGNAQATFPVGLLSFVSKFSVD
FGQMMAAGVLALIPACLFFLLIQRYLVQGLTAGAVKG