Protein Info for SMc01875 in Sinorhizobium meliloti 1021
Annotation: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 44% identical to LPXC_PSEHT: UDP-3-O-acyl-N-acetylglucosamine deacetylase (lpxC) from Pseudoalteromonas haloplanktis (strain TAC 125)
KEGG orthology group: K02535, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [EC: 3.5.1.-] (inferred from 100% identity to sme:SMc01875)Predicted SEED Role
"UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (EC 3.5.1.108)" (EC 3.5.1.108)
MetaCyc Pathways
- lipid IVA biosynthesis (P. gingivalis) (9/9 steps found)
- lipid IVA biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (6/6 steps found)
- lipid IVA biosynthesis (E. coli) (6/6 steps found)
- lipid IVA biosynthesis (H. pylori) (6/6 steps found)
- lipid IVA biosynthesis (P. putida) (6/6 steps found)
- lipid IVA biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
- lipid IVA biosynthesis (generic) (6/6 steps found)
- superpathway of (Kdo)2-lipid A biosynthesis (11/17 steps found)
- superpathway of Kdo2-lipid A biosynthesis (11/25 steps found)
KEGG Metabolic Maps
- 1,4-Dichlorobenzene degradation
- Caprolactam degradation
- Glutathione metabolism
- Lipopolysaccharide biosynthesis
- Lysine biosynthesis
- Nicotinate and nicotinamide metabolism
- Nucleotide sugars metabolism
- Sphingolipid metabolism
Isozymes
Compare fitness of predicted isozymes for: 3.5.1.-
Use Curated BLAST to search for 3.5.1.- or 3.5.1.108
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q92NM5 at UniProt or InterPro
Protein Sequence (322 amino acids)
>SMc01875 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (Sinorhizobium meliloti 1021) MKVTRMGIELLGFQTTIANPITLKGIGVHSGAEVEITFQPADADVGIVFQRVLAGGRLSE FRAVSSQVGNTDLCTVLGLSPATSIATIEHVMAAVYALGLDNLLIEVHGAEMPIMDGSSA PFIEAIEQAGIHSLAEKRRYIRILKPVRIESGASWSEFTPYDGMRFEVEIDFDCPLIGRQ AWKGDMTPSVFKRELSRARTFGFMRDVERLWAGGFALGSSLENSVVISDDNTVINVEGLR YTDEFVRHKTLDAVGDLSLAGAPFLGCYRSYRGGHRMNANALKALLSDPTAYEVVETATP RQRTRSRDMVAVAAPGFAPWSA