Protein Info for SMc01863 in Sinorhizobium meliloti 1021

Annotation: phospho-N-acetylmuramoyl-pentapeptide- transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 25 to 48 (24 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 245 to 262 (18 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details amino acids 294 to 317 (24 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details TIGR00445: phospho-N-acetylmuramoyl-pentapeptide-transferase" amino acids 38 to 366 (329 residues), 403.4 bits, see alignment E=4.4e-125 PF10555: MraY_sig1" amino acids 68 to 80 (13 residues), 24.1 bits, see alignment (E = 1.8e-09) PF00953: Glycos_transf_4" amino acids 99 to 289 (191 residues), 103.2 bits, see alignment E=1.5e-33

Best Hits

Swiss-Prot: 100% identical to MRAY_RHIME: Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01000, phospho-N-acetylmuramoyl-pentapeptide-transferase [EC: 2.7.8.13] (inferred from 100% identity to smk:Sinme_2159)

Predicted SEED Role

"Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13)" in subsystem Peptidoglycan Biosynthesis (EC 2.7.8.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q52952 at UniProt or InterPro

Protein Sequence (366 amino acids)

>SMc01863 phospho-N-acetylmuramoyl-pentapeptide- transferase (Sinorhizobium meliloti 1021)
MLIWLVELADHFQFFNLFRYITFRTGAALFTSALIVFLFGPAMIASLRIRQGKGQPIRAD
GPQTHFKKAGTPTMGGLMILTGIVVSSLLWADLSSIYVVSTLLVTLGFGAIGFYDDYLKV
TKQSEKGFSGKARLGIEFVIAAVAVFFMMQAALSAGAAGSTFGSSVTFPFFKDLMLNLGY
FFVLFGGFVIVGAGNSVNLTDGLDGLAIVPVMIASAAFGLIAYLAGNAVFANYLQIHFVP
GTGELAVILGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGLIGTVAVATKHEIVMIIIG
GLFVIETLSVIIQVFWFKRTGHRVFLMAPIHHHFEKKGWTESQVVIRFWIIAVILAMVGL
STLKLR