Protein Info for SMc01851 in Sinorhizobium meliloti 1021

Annotation: amino acid efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 63 to 88 (26 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 151 to 175 (25 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details PF01810: LysE" amino acids 15 to 201 (187 residues), 111 bits, see alignment E=2.6e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc01851)

Predicted SEED Role

"cell processes; transport of small molecules; amino acids, amines, peptides"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NK8 at UniProt or InterPro

Protein Sequence (211 amino acids)

>SMc01851 amino acid efflux protein (Sinorhizobium meliloti 1021)
MSFEHWFAFAAASAVLLAIPGPTILLVISYALGHGRKIAGATVAGVALGDFTAMTASMLG
LGALLATSAAVFTVLKWIGAAYLVWLGIKLWRAPVGNDSGSTVETSPAERPLRIFLHTYA
VTALNPKSILFFVAFLPQFLDLSRPLFAQMAIFETTFLILATINAALYAWLAAAAGSTIR
KPNIRRIVNRLGGSLLIGAGFLTAGLKRATS