Protein Info for SMc01830 in Sinorhizobium meliloti 1021

Annotation: urease accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 TIGR00101: urease accessory protein UreG" amino acids 8 to 197 (190 residues), 333.8 bits, see alignment E=1.8e-104 PF02492: cobW" amino acids 10 to 180 (171 residues), 134.6 bits, see alignment E=1.6e-43

Best Hits

Swiss-Prot: 100% identical to UREG_RHIME: Urease accessory protein UreG (ureG) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03189, urease accessory protein (inferred from 100% identity to smk:Sinme_2511)

MetaCyc: 62% identical to urease accessory protein GTPase UreG (Helicobacter pylori 26695)

Predicted SEED Role

"Urease accessory protein UreG" in subsystem Urea decomposition

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MY5 at UniProt or InterPro

Protein Sequence (203 amino acids)

>SMc01830 urease accessory protein (Sinorhizobium meliloti 1021)
MPSKNGPLRIGIGGPVGSGKTALTDKLCKAMREKYSVAVVTNDIYTKEDAEALVRMQALP
SERIVGVETGGCPHTAIREDASINLQAIADLNRRIPDLDVVFIESGGDNLAATFSPDLAD
LTIYVISVCQGEEIPRKGGPGITRSDLLVINKKDLAPYVGADLGVMERDAARMRAEKPFV
FSDMKRGDGVERIVEFLTVHGGL