Protein Info for SMc01814 in Sinorhizobium meliloti 1021

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 PF14691: Fer4_20" amino acids 20 to 129 (110 residues), 121 bits, see alignment E=8.8e-39 PF07992: Pyr_redox_2" amino acids 142 to 431 (290 residues), 112.9 bits, see alignment E=8.4e-36 PF00890: FAD_binding_2" amino acids 143 to 177 (35 residues), 24.4 bits, see alignment 6.4e-09 PF13450: NAD_binding_8" amino acids 145 to 177 (33 residues), 34.9 bits, see alignment (E = 6.3e-12) PF01593: Amino_oxidase" amino acids 151 to 177 (27 residues), 20.2 bits, see alignment (E = 1.3e-07)

Best Hits

KEGG orthology group: K00266, glutamate synthase (NADPH/NADH) small chain [EC: 1.4.1.13 1.4.1.14] (inferred from 100% identity to smk:Sinme_2495)

Predicted SEED Role

"Pyridine nucleotide-disulphide oxidoreductase associated with reductive pyrimidine catabolism" in subsystem Pyrimidine utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13, 1.4.1.14

Use Curated BLAST to search for 1.4.1.13 or 1.4.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92N00 at UniProt or InterPro

Protein Sequence (453 amino acids)

>SMc01814 oxidoreductase (Sinorhizobium meliloti 1021)
MGTTQSGILGGRLPLAEYEANFSDLHPSLDRHEALVAADRCYFCHDAPCMTACPTSIDIP
LFIRQIATGNPIGSAKTIFDQNILGGMCARVCPTETLCEEACVRNTAEERPVEIGRLQRY
ATDIAMRENKQFYSRAARSGRRVAVVGAGPAGLACAHRLAVKGHDVVIYDAREKSGGLNE
YGIAAYKAVDDFAQREVEYVLSVGGIEVSHGKALGRDFSLADLAEEFDAVFLGLGLAGVN
ALRIEGENAEGVEDAVDFIAALRQSKTKADIPVGRRVVVLGGGMTAIDAAVQAKLLGAEE
VTICYRRGKEHMNASEFEQDLAASKGVTIRHWLQPKRIAVKDGRVAGIELDYTTLENGKL
TTTGETGIIAADQIFKAIGQAFEASGLGALRMESGRIVVDSEGRTSLEKVWAGGDCVLGG
EDLTVSAVAMGRDAAGSIDRAFAVAQPLASAVA