Protein Info for SMc01732 in Sinorhizobium meliloti 1021

Annotation: 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 TIGR00965: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase" amino acids 20 to 295 (276 residues), 407.2 bits, see alignment E=1.7e-126 PF14805: THDPS_N_2" amino acids 20 to 85 (66 residues), 90.1 bits, see alignment E=1.3e-29 PF00132: Hexapep" amino acids 193 to 228 (36 residues), 29.5 bits, see alignment 6.4e-11 PF14602: Hexapep_2" amino acids 193 to 227 (35 residues), 44.2 bits, see alignment 1.9e-15

Best Hits

Swiss-Prot: 100% identical to DAPD_RHIME: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00674, 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase [EC: 2.3.1.117] (inferred from 100% identity to sme:SMc01732)

MetaCyc: 64% identical to tetrahydrodipicolinate succinylase (Escherichia coli K-12 substr. MG1655)
2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase. [EC: 2.3.1.117]

Predicted SEED Role

"2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117)" in subsystem Lysine Biosynthesis DAP Pathway (EC 2.3.1.117)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.117

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SG5 at UniProt or InterPro

Protein Sequence (296 amino acids)

>SMc01732 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase (Sinorhizobium meliloti 1021)
MQHNAELEGFPMTNHDLASLSQTIETAFEGRDAVNTGTRGAVRDAVETALNLLDSGKVRV
AERSEDGTWTVNQWLKKAVLLSFRLNPMELVRGGPGEAVWWDKVASKFDGWSVNEFEKAG
FRAVPNCVVRRSAYIAPNAVLMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGV
GIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEV
MYGEVPPYSVVVAGSMASGSTMANGQPAPNLYCAVIVKRVDEKTRSKTGINELLRD