Protein Info for SMc01641 in Sinorhizobium meliloti 1021

Annotation: carnitinyl-CoA dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF00378: ECH_1" amino acids 12 to 262 (251 residues), 199.5 bits, see alignment E=6.3e-63 PF16113: ECH_2" amino acids 19 to 244 (226 residues), 91.7 bits, see alignment E=6.7e-30

Best Hits

Swiss-Prot: 58% identical to CAID_SALAR: Carnitinyl-CoA dehydratase (caiD) from Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

KEGG orthology group: K08299, carnitinyl-CoA dehydratase [EC: 4.2.1.-] (inferred from 100% identity to sme:SMc01641)

Predicted SEED Role

"Enoyl-CoA hydratase [branched-chain amino acid degradation] (EC 4.2.1.17)" (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-, 4.2.1.17

Use Curated BLAST to search for 4.2.1.- or 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NF2 at UniProt or InterPro

Protein Sequence (263 amino acids)

>SMc01641 carnitinyl-CoA dehydratase (Sinorhizobium meliloti 1021)
MTPMTGPILTRREGGILEVTIDRPKANAIDLKTSRVMGEIFRDFRDDPELRVAIITGAGE
KFFCPGWDLKAAAEGDPVDGDYGVGGFGGMQELRDLNKPIIAAVNGICCGGGLEIALSTD
IILAAEHASFALPEIRSGTLADAASIKLPKRIPYHIAMDMLLTGRWLDVVEANRWGFVNE
ILPAGRLMDRAWELARLLESGPPLVYAAIKEVVRDAEGRDFQTTMNKVTRRQFRTVDVLY
SSEDQLEGARAFAEKRDPVWKGR