Protein Info for SMc01635 in Sinorhizobium meliloti 1021

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00106: adh_short" amino acids 7 to 195 (189 residues), 175.6 bits, see alignment E=1.3e-55 PF08659: KR" amino acids 9 to 167 (159 residues), 34.8 bits, see alignment E=2.4e-12 PF13561: adh_short_C2" amino acids 12 to 249 (238 residues), 203.2 bits, see alignment E=7.4e-64

Best Hits

Swiss-Prot: 40% identical to YXBG_BACSU: Uncharacterized oxidoreductase YxbG (yxbG) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to sme:SMc01635)

MetaCyc: 37% identical to 2-dehydro-3-deoxy-L-fuconate 4-dehydrogenase (Xanthomonas campestris pv. campestris)
RXN-22641 [EC: 1.1.1.434]

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.434

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NF8 at UniProt or InterPro

Protein Sequence (253 amino acids)

>SMc01635 oxidoreductase (Sinorhizobium meliloti 1021)
MILNNRIAIVTGAGSGIGRAGAAIMAREGAHVVVVDRSVEAAGDTVAAIAAGGGSAEALA
VDVTDDDALADGIADILYRHGRIDILHNHAGAQVAGDLEEVEVAGFDRSWNLNVRAHFMA
ARLVMPSMKKAGRGVIVNTSSSSGVLYDREMIAYTTTKHAVIAMTRQMAGDYAKYGVRVN
ALCPGWVDTPFNEPFIDQMGGREAIEAYIRERVPLGRWASVDEIAESILFLVSDRSSYMT
GQILVVDGGETVV